grchire.com

People Operations Manager

Civisanalytics
Chicago
Updated: Apr 8, 2026
grccomplianceiamdata-privacyllmdata-analystdesignqa

About the Role

Please note that candidates must currently live in the following states: DC, Florida, Illinois, Maryland, Michigan, North Carolina, New York, Pennsylvania, Texas, Virginia

Civis Analytics is hiring a People Operations Manager to own the full people function for a lean, mission-driven analytics company.  We serve non-profits like Doctors Without Borders, Sierra Club, and Human Rights Campaign, as well as government agencies and Fortune 500 companies.

This is a department-of-one role reporting to the CFO.  You'll have high autonomy to build and maintain the systems that keep our people operations running well — from compliance to recruiting to payroll & benefits.

Salary: $96,000 annually

What You'll Do

  • Manage day-to-day HR operations including employee relations, onboarding, offboarding, and policy administration
  • Own compliance across all employee states, keeping the company current on multi-state employment law requirements
  • Administer payroll with accuracy and timeliness
  • Manage benefits programs, including open enrollment, vendor relationships, and employee support
  • Lead recruiting across functions, from job posting through offer — partnering closely with hiring managers
  • Serve as the primary point of contact for employee questions on HR, benefits, and payroll
  • Identify gaps in people operations systems or processes and build practical solutions

What We're Looking For (Minimum Qualifications)

  • 4+ years of HR experience with demonstrated strength in HR operations and multi-state compliance
  • Strong second competency in either recruiting OR payroll and benefits administration
  • Comfort operating independently with minimal oversight — this role owns its domain
  • Working knowledge of multi-state employment law (we operate in 12+ states)
  • Experience with HRIS, payroll, and ATS platforms
  • Strong judgment, discretion, and communication skills
  • US work authorization required

Bonus Points (Preferred Qualifications)

  • Experience in both recruiting and payroll/benefits (not just one)
  • Prior experience as a solo HR practitioner or in a small team environment
  • Experience supporting a tech, analytics, or data-driven company
  • Hands-on experience with Paycom
  • Experience applying AI tools or automation to HR workflows
  • PHR, SHRM-CP, or equivalent certification

You Should Apply If:

  • You're energized by owning a function end-to-end, not just executing tasks
  • You're comfortable building processes from scratch and figuring things out
  • You can hold strategic HR thinking alongside day-to-day execution

You Should Not Apply If:

  • You need a specialized team around you to get work done
  • You prefer to focus on one HR discipline rather than span across several
  • Multi-state compliance feels like a stretch rather than a strength

Civis embraces the individuality of our employees and we celebrate each other's differences. Our products, services, and culture benefit from and thrive on the unique perspectives brought by each person in our Civis community. We're proud to be an equal opportunity workplace, and we are committed to equal employment opportunity regardless of race, age, sex, color, ancestry, religion, national origin, sexual orientation, gender identity, citizenship, marital status, disability, or Veteran status. If you have a disability or special need that requires accommodation, please contact internalrecruiting@civisanalytics.com

In compliance with federal law, all persons hired will be required to verify identity and eligibility to work in the United States.

EEO IS THE LAW

EEO Supplement

Pay Transparency

Employee and Applicant Privacy Notice