grchire.com

Sr. Product Manager

6sense
Boston
Updated: Aug 30, 2025
productiamdata-privacydata-engdesignmarketingsalesremotefintech

About the Role

Our Mission: 

6sense is on a mission to revolutionize how B2B organizations create revenue by predicting customers most likely to buy and recommending the best course of action to engage anonymous buying teams. 6sense Revenue AI is the only sales and marketing platform to unlock the ability to create, manage and convert high-quality pipeline to revenue. 

Our People: 

People are the heart and soul of 6sense. We serve with passion and purpose. We live by our Being 6sense values of Accountability, Growth Mindset, Integrity, Fun and One Team. Every 6sensor plays a part in defining the future of our industry-leading technology.  6sense is a place where difference-makers roll up their sleeves, take risks, act with integrity, and measure success by the value we create for our customers. 

We want 6sense to be the best chapter of your career. 

Role: Senior Product Manager Sales Intelligence 

The Sales Intelligence team at 6sense is responsible for building tools for sales reps which help them in prospecting more efficiently. We amalgamate first party data (customer systems) with 6sense proprietary data (intent, web engagement, etc.) and third-party data (partner intent) to answer the questions of: (a) which accounts should I prioritize now, (b) who should I reach out to in those accounts, and (c) how do I personalize my outreach to get better response rates. 

Role & Responsibilities 

  • Gain a deep understanding of customer experience, identify and fill product gaps and generate new ideas that drive growth, improve customer experience and increase retention 
  • Shape the long-term vision of the product by considering business goals, data analysis & technical challenges, and manage execution on that vision from conception to release to adoption (maturity) 
  • Collaborate with internal and external stakeholders while managing execution 
  • Ensure that required documentation (PRDs, knowledge base articles, customer communication, etc.) is prepared and updated 
  • Ensure that product health & performance metrics are tracked and reported 
  • Build market and competitive awareness by comparing the company’s product to competitors and tracking industry & technology trends 

Preferred Candidates will have 

  • Good communication skills, to clearly communicate goals, requirements, and desired outcomes to cross-functional teams and leadership 
  • Experience of collaborating with multiple internal and external stakeholders to develop product requirements, while also driving the implementation and delivery of products 
  • Experience in understanding customer personas, conducting user interviews and identifying user pain points, and then translating them into product requirements 
  • Ability to develop detailed business requirements and user stories for creation of product specifications and feature requests 
  • Strong data-driven problem-solving capabilities 
  • Comfort with diving deeper into technical aspects of the product 
  • 5+ years of product management experience; Experience on working with sales tech or martech products or with SAAS companies is a plus 

Base Salary Range: $158,400 – $237,600. The base salary range represents the anticipated low and high end of the base salary range for this position. Actual salaries may vary and may be above or below the range based on various factors, including but not limited to work location and experience. The base salary is one component of 6sense’s total compensation package for this position. Other compensation may include a bonus program or commission plan, and stock options if approved by 6sense’s board. In addition, 6sense provides a variety of benefits, including generous health insurance coverage, life, and disability insurance, a 401K employer matching program, paid holidays, self-care days, and paid time off (PTO). #Li-remote

Notice of Collection and Use of Personal Information for California Residents: California Recruitment Privacy Notice and Policy

Our Benefits: 

Full-time employees can take advantage of health coverage, paid parental leave, generous paid time-off and holidays, quarterly self-care days off, and stock options. We’ll make sure you have the equipment and support you need to work and connect with your teams, at home or in one of our offices. 

We have a growth mindset culture that is represented in all that we do, from onboarding through to numerous learning and development initiatives including access to our LinkedIn Learning platform. Employee well-being is also top of mind for us. We host quarterly wellness education sessions to encourage self care and personal growth. From wellness days to ERG-hosted events, we celebrate and energize all 6sense employees and their backgrounds. 

Equal Opportunity Employer: 

6sense is an Equal Employment Opportunity and Affirmative Action Employers. Qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender perception or identity, national origin, age, marital status, protected veteran status, or disability status. If you require reasonable accommodation in completing this application, interviewing, completing any pre-employment testing, or otherwise participating in the employee selection process, please direct your inquiries to jobs@6sense.com. 

We are aware of recruiting impersonation attempts that are not affiliated with 6sense in any way. All email communications from 6sense will originate from the @6sense.com domainWe will not initially contact you via text message and will never request paymentsIf you are uncertain whether you have been contacted by an official 6sense employee, reach out to jobs@6sense.com 

6sense is committed to protecting the privacy and security of your personal information. We will process your personal data for the purposes of the recruitment exercise, which may include assessing your suitability for the role, background, and reference checks, where applicable. Please see our recruitment privacy policy for more information: Recruitment Privacy Notice

Our Benefits: 

Full-time employees can take advantage of health coverage, paid parental leave, generous paid time-off and holidays, quarterly self-care days off, and stock options. We’ll make sure you have the equipment and support you need to work and connect with your teams, at home or in one of our offices. 

We have a growth mindset culture that is represented in all that we do, from onboarding through to numerous learning and development initiatives including access to our LinkedIn Learning platform. Employee well-being is also top of mind for us. We host quarterly wellness education sessions to encourage self care and personal growth. From wellness days to ERG-hosted events, we celebrate and energize all 6sense employees and their backgrounds. 

Equal Opportunity Employer: 

6sense is an Equal Employment Opportunity and Affirmative Action Employers. Qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender perception or identity, national origin, age, marital status, protected veteran status, or disability status. If you require reasonable accommodation in completing this application, interviewing, completing any pre-employment testing, or otherwise participating in the employee selection process, please direct your inquiries to jobs@6sense.com. 

We are aware of recruiting impersonation attempts that are not affiliated with 6sense in any way. All email communications from 6sense will originate from the @6sense.com domain. We will not initially contact you via text message and will never request payments. If you are uncertain whether you have been contacted by an official 6sense employee, reach out to jobs@6sense.com